"actions" : [ ], }, Free installation* 12 month contracts. } "context" : "", { if ( !watching ) { "action" : "rerender" "event" : "unapproveMessage", "includeRepliesModerationState" : "false", "event" : "addMessageUserEmailSubscription", { clearWarning(pagerId); "event" : "AcceptSolutionAction", { $('#node-menu li.has-sub>a').on('click', function(){ } ] LITHIUM.AjaxSupport.ComponentEvents.set({ ] { ] }, "event" : "addThreadUserEmailSubscription", { ] ] "event" : "ProductMessageEdit", "action" : "rerender" { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/30466/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Z0yB-NXgj2I_3npA9mUUK1d6VBJq7XQd3L0qU4zcQR8. ] "action" : "rerender" "message" : "2053276", var key = e.keyCode; } "entity" : "2125334", "event" : "editProductMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "deleteMessage", "actions" : [ } ] "actions" : [ }, "context" : "envParam:feedbackData", "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "actions" : [ { } { "selector" : "#messageview_8", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, }, "context" : "envParam:quiltName", { "event" : "expandMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/30466/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QENBTnNzHuSB8UN6ZSxlSTTD7pguKZtD4BiRA0GkauI. "useSimpleView" : "false", Was ist das denn? LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); $(this).next().toggle(); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/1234567/thread-id/30466/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jvs8QNGFHeF1LDfyzz3L5UU6felNf92KMuGIal8L3g0. { "action" : "pulsate" "actions" : [ "disableKudosForAnonUser" : "false", "context" : "envParam:feedbackData", "action" : "rerender" if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") ] } { } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } }, "actions" : [ { }, "action" : "rerender" ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); ] Bist du sicher, dass du fortfahren möchtest? "eventActions" : [ { ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", { "action" : "rerender" { } o.innerHTML = ""; ], }, "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax'); { } "event" : "MessagesWidgetAnswerForm", o.innerHTML = "Page must be an integer number. } ] "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); $('#vodafone-community-header .lia-search-input-wrapper').hide(); }, "actions" : [ }, return false; "action" : "pulsate" "context" : "envParam:quiltName,expandedQuiltName", }, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, { $(document).ready(function(){ }, { "eventActions" : [ if ( Number(val) > 4 ) { } }, "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "actions" : [ "actions" : [ { { "actions" : [ "context" : "envParam:selectedMessage", }); "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] { "context" : "", ] { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "triggerEvent" : "click", { "event" : "approveMessage", { }); } ] "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ }, "action" : "pulsate" { { { "action" : "rerender" "disallowZeroCount" : "false", { } "useSimpleView" : "false", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { "kudosable" : "true", } "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/30466/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Z0yB-NXgj2I_3npA9mUUK1d6VBJq7XQd3L0qU4zcQR8. { Vodafone fibre optic broadband. "actions" : [ } }, { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", }); }, LITHIUM.Loader.runJsAttached(); }, LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. watching = false; $(document).ready(function(){ "initiatorBinding" : true, Bist du sicher, dass du fortfahren möchtest? "context" : "", "initiatorBinding" : true, ] }, } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/30466/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Z0yB-NXgj2I_3npA9mUUK1d6VBJq7XQd3L0qU4zcQR8. LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'lkedtQp5-xplMHgYXM9yYRbAuz5YB_JBpcxnhKV31as. } "actions" : [ "action" : "rerender" Ich behelfe mich momentan mit einem freien 6to4-Tunnel, was die Performance deutlich mindert. { LITHIUM.AjaxSupport.ComponentEvents.set({ }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233121}); "displayStyle" : "horizontal", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "actions" : [ }, { { "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", "actions" : [ } LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:selectedMessage", o.innerHTML = "Page number must be 1 or greater. "event" : "removeMessageUserEmailSubscription", { "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { "action" : "rerender" "showCountOnly" : "false", "parameters" : { })(LITHIUM.jQuery); { ] $('li.close-on-click').on('click',resetMenu); "event" : "editProductMessage", "action" : "rerender" { "actions" : [ "action" : "rerender" "actions" : [ } else { "event" : "approveMessage", "event" : "AcceptSolutionAction", "componentId" : "forums.widget.message-view", { "context" : "", { "actions" : [ } { { "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2102034,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { "actions" : [ } { "context" : "envParam:quiltName", { "action" : "pulsate" "initiatorBinding" : true, "context" : "envParam:quiltName,expandedQuiltName", ] Von einem multinationalen Telekommunikationsanbieter kann man erwarten, dass er den Stand der Technik zeitnah implementiert, und nicht Jahrzehnte späterEdit by Matthes (Mod): mit Hinweis auf die Forenregel. { ] }, "message" : "2125334", { LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ }, "event" : "unapproveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "message" : "2053276", ;(function($) { }, { if (val.trim() == "") "context" : "", }, "action" : "rerender" "action" : "rerender" o.innerHTML = "Page number can\'t exceed 4. "includeRepliesModerationState" : "false", }, "selector" : "#kudosButtonV2_6", "useTruncatedSubject" : "true", "truncateBody" : "true", }, "event" : "ProductAnswerComment", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "context" : "", { }, { "actions" : [ }, ] $('div[class*="-menu-btn"]').removeClass('active'); } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "useSubjectIcons" : "true", "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); }, "actions" : [ ', 'ajax'); "displayStyle" : "horizontal", } "event" : "editProductMessage", "action" : "rerender" { LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "disableLabelLinks" : "false", { "kudosLinksDisabled" : "false", "action" : "rerender" ] }, "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", ], ] "context" : "", ] "actions" : [ ] "context" : "", "actions" : [ "displayStyle" : "horizontal", ;(function($) { ] "message" : "2125334", "event" : "MessagesWidgetAnswerForm", "actions" : [ "action" : "rerender" } Vodafone offer combined broadband and landline phone deals, where you can bundle together the two services in one. "truncateBody" : "true", "event" : "editProductMessage", Offers for new Vodafone Home customers. "action" : "rerender" "action" : "addClassName" }, IPv6 gibt es schon seit 1995, wurde seit dem hier und da noch umgebogen, weshalb wohl viele (auch Hersteller) noch warteten mit der Implementierung. } ] "context" : "", "eventActions" : [ ], "action" : "rerender" } { "accessibility" : false, // Set start to true only if the first key in the sequence is pressed "actions" : [ "event" : "editProductMessage", "event" : "approveMessage", "actions" : [ "event" : "unapproveMessage", "eventActions" : [ ] ', 'ajax'); "eventActions" : [ "actions" : [ { "action" : "rerender" { element.siblings('li').removeClass('active'); ], }, } { "messageViewOptions" : "1111110111111111111110111110100101001101" }, "actions" : [ "useSimpleView" : "false", "event" : "deleteMessage", "revokeMode" : "true", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2103067,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); $(document).ready(function() { "context" : "envParam:entity", "actions" : [ "context" : "envParam:quiltName", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ { { "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "displayStyle" : "horizontal", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2052069 .lia-rating-control-passive', '#form_1'); "action" : "rerender" "disableLinks" : "false", "action" : "rerender" "actions" : [ "context" : "", }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); ]